Lineage for d4a8la_ (4a8l A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 974184Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 974224Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 974397Protein automated matches [190298] (1 species)
    not a true protein
  7. 974398Species Streptomyces rubiginosus [TaxId:1929] [187248] (11 PDB entries)
  8. 974402Domain d4a8la_: 4a8l A: [186737]
    automated match to d1dxia_
    complexed with co, edo

Details for d4a8la_

PDB Entry: 4a8l (more details), 1.35 Å

PDB Description: protein crystallization and microgravity: glucose isomerase crystals grown during the pcdf-protein mission
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4a8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a8la_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d4a8la_:

Click to download the PDB-style file with coordinates for d4a8la_.
(The format of our PDB-style files is described here.)

Timeline for d4a8la_: