Lineage for d3zzsc_ (3zzs C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1139051Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 1139052Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
  6. 1139236Protein automated matches [191248] (4 species)
    not a true protein
  7. 1139272Species Geobacillus stearothermophilus [TaxId:1422] [189760] (1 PDB entry)
  8. 1139275Domain d3zzsc_: 3zzs C: [186678]
    automated match to d1c9sg_
    complexed with trp

Details for d3zzsc_

PDB Entry: 3zzs (more details), 1.49 Å

PDB Description: engineered 12-subunit bacillus stearothermophilus trp rna-binding attenuation protein (trap)
PDB Compounds: (C:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d3zzsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zzsc_ b.82.5.1 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvie

SCOPe Domain Coordinates for d3zzsc_:

Click to download the PDB-style file with coordinates for d3zzsc_.
(The format of our PDB-style files is described here.)

Timeline for d3zzsc_: