Lineage for d3zxea_ (3zxe A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373886Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 protein domains)
  6. 2374061Protein Galectin-7 [100926] (1 species)
  7. 2374062Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 2374063Domain d3zxea_: 3zxe A: [186650]
    automated match to d1bkza_
    complexed with pgz

Details for d3zxea_

PDB Entry: 3zxe (more details), 1.67 Å

PDB Description: Crystal structure of Human Galectin-7 in complex with a galactose- benzylphosphate inhibitor
PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d3zxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxea_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

SCOPe Domain Coordinates for d3zxea_:

Click to download the PDB-style file with coordinates for d3zxea_.
(The format of our PDB-style files is described here.)

Timeline for d3zxea_: