SCOPe 2.08: Domain d3zxea_: 3zxe A:

Lineage for d3zxea_ (3zxe A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d3zxea_: 3zxe A: [186650]
   automated match to d1bkza_
   complexed with pgz

Details for d3zxea_

PDB Entry: 3zxe, 1.67 Å

PDB Description: Crystal structure of Human Galectin-7 in complex with a galactose- benzylphosphate inhibitor

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d3zxea_:

Sequence; same for both SEQRES and ATOM records:

>d3zxea_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

Timeline for d3zxea_:

• d3zxea_ first appeared in SCOPe 2.01
  
• d3zxea_ appears in SCOPe 2.07