| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Galectin-7 [100926] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries) |
| Domain d3zxeb_: 3zxe B: [186651] automated match to d1bkza_ complexed with pgz |
PDB Entry: 3zxe (more details), 1.67 Å
SCOPe Domain Sequences for d3zxeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxeb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
vggdvqldsvrif
Timeline for d3zxeb_: