Lineage for d3zwmh1 (3zwm H:1-252)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466660Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2466704Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2466838Protein automated matches [191078] (1 species)
    not a true protein
  7. 2466839Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)
  8. 2466887Domain d3zwmh1: 3zwm H:1-252 [186615]
    Other proteins in same PDB: d3zwmb2, d3zwmc2, d3zwmd2, d3zwme2, d3zwmf2, d3zwmh2
    automated match to d1r12a_
    complexed with cxr, nad

Details for d3zwmh1

PDB Entry: 3zwm (more details), 2.5 Å

PDB Description: Crystal structure of ADP ribosyl cyclase complexed with substrate NAD and product cADPR
PDB Compounds: (H:) ADP-ribosyl cylcase

SCOPe Domain Sequences for d3zwmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwmh1 c.23.14.3 (H:1-252) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrlak

SCOPe Domain Coordinates for d3zwmh1:

Click to download the PDB-style file with coordinates for d3zwmh1.
(The format of our PDB-style files is described here.)

Timeline for d3zwmh1: