Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (3 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (3 PDB entries) |
Domain d3zuca_: 3zuc A: [186574] automated match to d1nbca_ complexed with 1pe, ca, edo, ni |
PDB Entry: 3zuc (more details), 1 Å
SCOPe Domain Sequences for d3zuca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zuca_ b.2.2.0 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} gshmnlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcd wspvgssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynq addysfnssattytswdkvtaysaegliwgiep
Timeline for d3zuca_: