Lineage for d3zted_ (3zte D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559779Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 1559780Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 1559964Protein automated matches [191248] (4 species)
    not a true protein
  7. 1559969Species Bacillus licheniformis [TaxId:1402] [189758] (1 PDB entry)
  8. 1559973Domain d3zted_: 3zte D: [186546]
    automated match to d1wapa_
    complexed with trp

Details for d3zted_

PDB Entry: 3zte (more details), 2.41 Å

PDB Description: crystal structure of the trp rna-binding attenuation protein (trap) from bacillus licheniformis.
PDB Compounds: (D:) tryptophan operon RNA-binding attenuation protein (trap)

SCOPe Domain Sequences for d3zted_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zted_ b.82.5.1 (D:) automated matches {Bacillus licheniformis [TaxId: 1402]}
dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
gemkseskk

SCOPe Domain Coordinates for d3zted_:

Click to download the PDB-style file with coordinates for d3zted_.
(The format of our PDB-style files is described here.)

Timeline for d3zted_: