Lineage for d3zr0b_ (3zr0 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666148Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1666149Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1666150Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1666290Protein automated matches [190465] (3 species)
    not a true protein
  7. 1666303Species Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries)
  8. 1666307Domain d3zr0b_: 3zr0 B: [186524]
    automated match to d1irya_
    protein/DNA complex; complexed with 8og, so4

Details for d3zr0b_

PDB Entry: 3zr0 (more details), 1.8 Å

PDB Description: crystal structure of human mth1 in complex with 8-oxo-dgmp
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d3zr0b_:

Sequence, based on SEQRES records: (download)

>d3zr0b_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltv
dalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdds
ywfplllqkkkfhgyfkfqgqdtildytlrevdtv

Sequence, based on observed residues (ATOM records): (download)

>d3zr0b_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gasrlytlvlvlvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvdalh
kvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsywfp
lllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d3zr0b_:

Click to download the PDB-style file with coordinates for d3zr0b_.
(The format of our PDB-style files is described here.)

Timeline for d3zr0b_: