Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries) |
Domain d3vgwe_: 3vgw E: [186491] automated match to d1rava_ complexed with nag, nvz, so4 |
PDB Entry: 3vgw (more details), 1.6 Å
SCOPe Domain Sequences for d3vgwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgwe_ b.61.1.1 (E:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif trl
Timeline for d3vgwe_: