Lineage for d1rava_ (1rav A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805789Protein Avidin [50880] (1 species)
  7. 2805790Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)
  8. 2805799Domain d1rava_: 1rav A: [27409]

Details for d1rava_

PDB Entry: 1rav (more details), 2.2 Å

PDB Description: recombinant avidin
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1rava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rava_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

SCOPe Domain Coordinates for d1rava_:

Click to download the PDB-style file with coordinates for d1rava_.
(The format of our PDB-style files is described here.)

Timeline for d1rava_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ravb_