Lineage for d1rava_ (1rav A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) 
Protein Avidin [50880] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries) 
Domain d1rava_: 1rav A: [27409]
Details for d1rava_
PDB Entry: 1rav (more details), 2.2 Å
PDB Description: recombinant avidin
PDB Compounds: (A:) AvidinSCOPe Domain Sequences for d1rava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rava_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt
SCOPe Domain Coordinates for d1rava_:
Click to download the PDB-style file with coordinates for d1rava_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rava_:
- d1rava_ first appeared (with stable ids) in SCOP 1.55
- d1rava_ appears in SCOPe 2.07
View in 3D
