| Class b: All beta proteins [48724] (176 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
| Protein automated matches [191276] (1 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:208964] [189874] (2 PDB entries) |
| Domain d3ussb_: 3uss B: [186394] automated match to d2gm6a1 complexed with cl, fe2, na, so4 |
PDB Entry: 3uss (more details), 2.7 Å
SCOPe Domain Sequences for d3ussb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ussb_ b.82.1.19 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
silrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqq
yllhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsga
rrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfis
gysnsrlpniwdlske
Timeline for d3ussb_: