SCOPe 2.05: Domain d3up9a_: 3up9 A:

Lineage for d3up9a_ (3up9 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Actinomyces odontolyticus [TaxId:411466] [189886] (1 PDB entry)

8. Domain d3up9a_: 3up9 A: [186369]
   automated match to d1xs5a_
   complexed with mse, pe4, pg4

Details for d3up9a_

PDB Entry: 3up9, 2.35 Å

PDB Description: crystal structure of a putative lipoprotein (actodo_00931) from actinomyces odontolyticus atcc 17982 at 2.35 a resolution

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3up9a_:

Sequence, based on SEQRES records:

>d3up9a_ c.94.1.0 (A:) automated matches {Actinomyces odontolyticus [TaxId: 411466]}
dvvtltvgatpsphakiltyindnlaadagikldiveytdyvqpntalndgdldanfyqt
vpylenaekqfgynfeagegihleplgvfsnkhksldelpdggtigiisdtanqsralel
latqglvsipegdgdvnintvtklknfdfrevegpqlvrslddfdyavingnfaqeggkt
isgdalvvespvdnpavnvlvwkgdskkvdaiaklekllhsdevkqyiektwsdgsvipa
f

Sequence, based on observed residues (ATOM records):

>d3up9a_ c.94.1.0 (A:) automated matches {Actinomyces odontolyticus [TaxId: 411466]}
dvvtltvgatpsphakiltyindnlaadagikldiveytdyvqpntalndgdldanfyqt
vpylenaekqfgynfeagegihleplgvfsnkhksldelpdggtigiisdtanqsralel
latqglvsipegdvnintvtklknfdfrevegpqlvrslddfdyavingnfaqeggktis
gdalvvespvdnpavnvlvwkgdskkvdaiaklekllhsdevkqyiektwsdgsvipaf

Timeline for d3up9a_:

• d3up9a_ first appeared in SCOPe 2.01
  
• d3up9a_ appears in SCOPe 2.04
  
• d3up9a_ appears in SCOPe 2.06
  
• d3up9a_ appears in the current release, SCOPe 2.08