Lineage for d3up9a_ (3up9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163430Species Actinomyces odontolyticus [TaxId:411466] [189886] (1 PDB entry)
  8. 2163431Domain d3up9a_: 3up9 A: [186369]
    automated match to d1xs5a_
    complexed with mse, pe4, pg4

Details for d3up9a_

PDB Entry: 3up9 (more details), 2.35 Å

PDB Description: crystal structure of a putative lipoprotein (actodo_00931) from actinomyces odontolyticus atcc 17982 at 2.35 a resolution
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3up9a_:

Sequence, based on SEQRES records: (download)

>d3up9a_ c.94.1.0 (A:) automated matches {Actinomyces odontolyticus [TaxId: 411466]}
dvvtltvgatpsphakiltyindnlaadagikldiveytdyvqpntalndgdldanfyqt
vpylenaekqfgynfeagegihleplgvfsnkhksldelpdggtigiisdtanqsralel
latqglvsipegdgdvnintvtklknfdfrevegpqlvrslddfdyavingnfaqeggkt
isgdalvvespvdnpavnvlvwkgdskkvdaiaklekllhsdevkqyiektwsdgsvipa
f

Sequence, based on observed residues (ATOM records): (download)

>d3up9a_ c.94.1.0 (A:) automated matches {Actinomyces odontolyticus [TaxId: 411466]}
dvvtltvgatpsphakiltyindnlaadagikldiveytdyvqpntalndgdldanfyqt
vpylenaekqfgynfeagegihleplgvfsnkhksldelpdggtigiisdtanqsralel
latqglvsipegdvnintvtklknfdfrevegpqlvrslddfdyavingnfaqeggktis
gdalvvespvdnpavnvlvwkgdskkvdaiaklekllhsdevkqyiektwsdgsvipaf

SCOPe Domain Coordinates for d3up9a_:

Click to download the PDB-style file with coordinates for d3up9a_.
(The format of our PDB-style files is described here.)

Timeline for d3up9a_: