SCOPe 2.05: Domain d3uo5a_: 3uo5 A:

Lineage for d3uo5a_ (3uo5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [90039] (46 PDB entries)

8. Domain d3uo5a_: 3uo5 A: [186356]
   automated match to d1ol5a_
   complexed with 0bx

Details for d3uo5a_

PDB Entry: 3uo5, 2.7 Å

PDB Description: Aurora A in complex with YL1-038-31

PDB Compounds: (A:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3uo5a_:

Sequence; same for both SEQRES and ATOM records:

>d3uo5a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
kkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemieg
rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
lkhnpsqrpmlrevlehpwitansskp

Timeline for d3uo5a_:

• d3uo5a_ first appeared in SCOPe 2.01
  
• d3uo5a_ appears in SCOPe 2.04
  
• d3uo5a_ appears in SCOPe 2.06
  
• d3uo5a_ appears in the current release, SCOPe 2.08