Lineage for d3ugya_ (3ugy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2301943Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 2302002Domain d3ugya_: 3ugy A: [186258]
    automated match to d1nxfa_
    complexed with cmo, hem

Details for d3ugya_

PDB Entry: 3ugy (more details), 2.1 Å

PDB Description: hbi (f80y) co bound
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3ugya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugya_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnyidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3ugya_:

Click to download the PDB-style file with coordinates for d3ugya_.
(The format of our PDB-style files is described here.)

Timeline for d3ugya_: