Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (19 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [189804] (2 PDB entries) |
Domain d3uduf_: 3udu F: [186244] automated match to d1cm7a_ complexed with cl, edo |
PDB Entry: 3udu (more details), 1.85 Å
SCOPe Domain Sequences for d3uduf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uduf_ c.77.1.1 (F:) automated matches {Campylobacter jejuni [TaxId: 197]} ktykvavlagdgigplvmkealkiltfiaqkynfsfelneakiggasidaygvalsdetl klceqsdailfgsvggpkwdnlpidqrperasllplrkhfnlfanlrpckiyeslthasp lkneiiqkgvdilcvreltggiyfgkqdlgkesaydteiytkkeieriariafesarirk kkvhlidkanvlassilwrevvanvakdyqdinleymyvdnaamqivknpsifdvmlcsn lfgdilsdelaaingslgllssaslndkgfglyepaggsapdiahlnianpiaqilsaal mlkysfkeeqaaqdienaislalaqgkmtkdlnaksylntdemgdcileilkendn
Timeline for d3uduf_: