Lineage for d3ubek1 (3ube K:11-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040384Domain d3ubek1: 3ube K:11-325 [186203]
    Other proteins in same PDB: d3ubeb_, d3ubed_, d3ubef_, d3ubeh_, d3ubej_, d3ubek2, d3ubel_
    automated match to d1ruyh_
    complexed with nag, sia

Details for d3ubek1

PDB Entry: 3ube (more details), 2.15 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lstc
PDB Compounds: (K:) hemagglutinin HA1

SCOPe Domain Sequences for d3ubek1:

Sequence, based on SEQRES records: (download)

>d3ubek1 b.19.1.2 (K:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

Sequence, based on observed residues (ATOM records): (download)

>d3ubek1 b.19.1.2 (K:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpecasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktsswpn
hdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpsts
adqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfeat
gnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcpk
yvkstklrlatglrnips

SCOPe Domain Coordinates for d3ubek1:

Click to download the PDB-style file with coordinates for d3ubek1.
(The format of our PDB-style files is described here.)

Timeline for d3ubek1: