SCOPe 2.08: Domain d3ubef_: 3ube F:

Lineage for d3ubef_ (3ube F:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3ubef_: 3ube F: [239848]
   Other proteins in same PDB: d3ubea_, d3ubec_, d3ubee_, d3ubeg_, d3ubei_, d3ubek1, d3ubek2
   automated match to d4n5zb_
   complexed with nag, sia

Details for d3ubef_

PDB Entry: 3ube, 2.15 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lstc

PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubef_:

Sequence; same for both SEQRES and ATOM records:

>d3ubef_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr

Timeline for d3ubef_:

• d3ubef_ first appeared in SCOPe 2.04
  
• d3ubef_ appears in SCOPe 2.07