Lineage for d3u8fa_ (3u8f A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047397Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1047398Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1047399Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1047532Protein automated matches [190420] (8 species)
    not a true protein
  7. 1047546Species Momordica balsamina [TaxId:3672] [189375] (22 PDB entries)
  8. 1047556Domain d3u8fa_: 3u8f A: [186109]
    automated match to d1ahaa_
    complexed with fgm, gol

Details for d3u8fa_

PDB Entry: 3u8f (more details), 1.8 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein in complex with mycolic acid at 1.8 a resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3u8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8fa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d3u8fa_:

Click to download the PDB-style file with coordinates for d3u8fa_.
(The format of our PDB-style files is described here.)

Timeline for d3u8fa_: