Lineage for d3u7qa_ (3u7q A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878197Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 1878308Protein automated matches [190199] (2 species)
    not a true protein
  7. 1878309Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)
  8. 1878310Domain d3u7qa_: 3u7q A: [186099]
    Other proteins in same PDB: d3u7qb_, d3u7qd_
    automated match to d1h1la_
    complexed with 1cl, ca, clf, hca, ics, imd, mg

Details for d3u7qa_

PDB Entry: 3u7q (more details), 1 Å

PDB Description: a. vinelandii nitrogenase mofe protein at atomic resolution
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d3u7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7qa_ c.92.2.3 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d3u7qa_:

Click to download the PDB-style file with coordinates for d3u7qa_.
(The format of our PDB-style files is described here.)

Timeline for d3u7qa_: