Lineage for d3u6za_ (3u6z A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047397Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1047398Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1047399Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1047532Protein automated matches [190420] (8 species)
    not a true protein
  7. 1047546Species Momordica balsamina [TaxId:3672] [189375] (22 PDB entries)
  8. 1047550Domain d3u6za_: 3u6z A: [186097]
    automated match to d1ahaa_
    protein/RNA complex; complexed with ade, gol, nag

Details for d3u6za_

PDB Entry: 3u6z (more details), 1.7 Å

PDB Description: crystal structure of the complex formed between type 1 ribosome inactivating protein and adenine at 1.7a resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3u6za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6za_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d3u6za_:

Click to download the PDB-style file with coordinates for d3u6za_.
(The format of our PDB-style files is described here.)

Timeline for d3u6za_: