Lineage for d3twya_ (3twy A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776027Protein C2 domain from protein kinase c (alpha) [49578] (1 species)
  7. 1776028Species Norway rat (Rattus norvegicus) [TaxId:10116] [49579] (5 PDB entries)
  8. 1776029Domain d3twya_: 3twy A: [185994]
    automated match to d1dsya_
    complexed with pb, so4

Details for d3twya_

PDB Entry: 3twy (more details), 1.5 Å

PDB Description: rat pkc c2 domain bound to pb
PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d3twya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twya_ b.7.1.2 (A:) C2 domain from protein kinase c (alpha) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
kllnqeegeyynvpipe

SCOPe Domain Coordinates for d3twya_:

Click to download the PDB-style file with coordinates for d3twya_.
(The format of our PDB-style files is described here.)

Timeline for d3twya_: