SCOPe 2.06: Domain d3twxb1: 3twx B:488-644

Lineage for d3twxb1 (3twx B:488-644)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (20 PDB entries)

8. Domain d3twxb1: 3twx B:488-644 [185993]
   Other proteins in same PDB: d3twxa2, d3twxb2
   automated match to d1awcb_
   complexed with edo, p6g, so4

Details for d3twxb1

PDB Entry: 3twx, 1.8 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human FNBP1 (chimeric peptide)

PDB Compounds: (B:) tankyrase-2

SCOPe Domain Sequences for d3twxb1:

Sequence; same for both SEQRES and ATOM records:

>d3twxb1 d.211.1.0 (B:488-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllq
hgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyei
cklllqhgadptkknrdgntpldlvkdgdtdiqdllr

Timeline for d3twxb1:

• d3twxb1 first appeared in SCOPe 2.01, called d3twxb_
  
• d3twxb1 was called d3twxb_ in SCOPe 2.05
  
• d3twxb1 appears in SCOPe 2.07
  
• d3twxb1 appears in the current release, SCOPe 2.08