![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein automated matches [190370] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
![]() | Domain d3tvxa1: 3tvx A:290-622 [185967] Other proteins in same PDB: d3tvxa2, d3tvxb2 automated match to d1oyna_ complexed with mg, pnx, so4, zn |
PDB Entry: 3tvx (more details), 2.84 Å
SCOPe Domain Sequences for d3tvxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvxa1 a.211.1.2 (A:290-622) automated matches {Human (Homo sapiens) [TaxId: 9606]} niprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfri pvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfaa aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrqr qslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhca dlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyiv hplwetwadlvhpdaqeildtlednrdwyysai
Timeline for d3tvxa1: