Lineage for d3tvxa1 (3tvx A:290-622)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2018992Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2019273Protein automated matches [190370] (1 species)
    not a true protein
  7. 2019274Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2019306Domain d3tvxa1: 3tvx A:290-622 [185967]
    Other proteins in same PDB: d3tvxa2, d3tvxb2
    automated match to d1oyna_
    complexed with mg, pnx, so4, zn

Details for d3tvxa1

PDB Entry: 3tvx (more details), 2.84 Å

PDB Description: The structure of PDE4A with pentoxifylline at 2.84A resolution
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4A

SCOPe Domain Sequences for d3tvxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvxa1 a.211.1.2 (A:290-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfri
pvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrqr
qslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhca
dlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvhpdaqeildtlednrdwyysai

SCOPe Domain Coordinates for d3tvxa1:

Click to download the PDB-style file with coordinates for d3tvxa1.
(The format of our PDB-style files is described here.)

Timeline for d3tvxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tvxa2