Lineage for d1arx__ (1arx -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154837Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 154838Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 154839Family a.93.1.1: CCP-like [48114] (6 proteins)
  6. 154943Protein Peroxidase [48117] (2 species)
  7. 154944Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries)
  8. 154951Domain d1arx__: 1arx - [18595]

Details for d1arx__

PDB Entry: 1arx (more details), 1.9 Å

PDB Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis

SCOP Domain Sequences for d1arx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arx__ a.93.1.1 (-) Peroxidase {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d1arx__:

Click to download the PDB-style file with coordinates for d1arx__.
(The format of our PDB-style files is described here.)

Timeline for d1arx__: