SCOPe 2.03: Domain d3tq7a_: 3tq7 A:

Lineage for d3tq7a_ (3tq7 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d3tq7a_: 3tq7 A: [185903]
   Other proteins in same PDB: d3tq7b_, d3tq7p_, d3tq7q_
   automated match to d1yiga1

Details for d3tq7a_

PDB Entry: 3tq7, 2.3 Å

PDB Description: EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d3tq7a_:

Sequence, based on SEQRES records:

>d3tq7a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
mqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatdegfvip
deggpqeeqeey

Sequence, based on observed residues (ATOM records):

>d3tq7a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
mqqvnvlkltvedlekerdfyfgklrnielicqenepvlqrivdilyatdeqeey

Timeline for d3tq7a_:

• d3tq7a_ first appeared in SCOPe 2.01
  
• d3tq7a_ appears in SCOPe 2.02
  
• d3tq7a_ appears in SCOPe 2.04
  
• d3tq7a_ appears in the current release, SCOPe 2.08