Lineage for d3tq7a_ (3tq7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015959Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2015960Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2015961Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 protein domains)
    Pfam PF03271
  6. 2015962Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2015963Species Human (Homo sapiens) [TaxId:9606] [140615] (10 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2015973Domain d3tq7a_: 3tq7 A: [185903]
    Other proteins in same PDB: d3tq7b_, d3tq7p_, d3tq7q_
    automated match to d1yiga1

Details for d3tq7a_

PDB Entry: 3tq7 (more details), 2.3 Å

PDB Description: EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d3tq7a_:

Sequence, based on SEQRES records: (download)

>d3tq7a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
mqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatdegfvip
deggpqeeqeey

Sequence, based on observed residues (ATOM records): (download)

>d3tq7a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
mqqvnvlkltvedlekerdfyfgklrnielicqenepvlqrivdilyatdeqeey

SCOPe Domain Coordinates for d3tq7a_:

Click to download the PDB-style file with coordinates for d3tq7a_.
(The format of our PDB-style files is described here.)

Timeline for d3tq7a_: