Lineage for d3tmta_ (3tmt A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408104Species Lobophyllia hemprichii [TaxId:46758] [187486] (12 PDB entries)
  8. 1408141Domain d3tmta_: 3tmt A: [185887]
    automated match to d1mova_
    complexed with so4

Details for d3tmta_

PDB Entry: 3tmt (more details), 2 Å

PDB Description: IrisFP, distorted chromophore
PDB Compounds: (A:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d3tmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmta_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
afhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvr
fhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyka
kekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d3tmta_:

Click to download the PDB-style file with coordinates for d3tmta_.
(The format of our PDB-style files is described here.)

Timeline for d3tmta_: