| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (7 species) not a true protein |
| Species Lobophyllia hemprichii [TaxId:46758] [187486] (9 PDB entries) |
| Domain d3tmta_: 3tmt A: [185887] automated match to d1mova_ complexed with so4 |
PDB Entry: 3tmt (more details), 2 Å
SCOPe Domain Sequences for d3tmta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tmta_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
afhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvr
fhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyka
kekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d3tmta_: