Class b: All beta proteins [48724] (178 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243 |
Family b.23.3.0: automated matches [191463] (1 protein) not a true family |
Protein automated matches [190714] (2 species) not a true protein |
Species Thermoanaerobacter tengcongensis [TaxId:119072] [189810] (2 PDB entries) |
Domain d3tkkc1: 3tkk C:1-299 [185869] Other proteins in same PDB: d3tkka2, d3tkkb2, d3tkkc2, d3tkkd2 automated match to d2f4la1 complexed with ca, zn |
PDB Entry: 3tkk (more details), 1.99 Å
SCOPe Domain Sequences for d3tkkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkkc1 b.23.3.0 (C:1-299) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkyslsadhhifafskenkpaisvksgdelevetmdcfsnqiqsnedkldemdwnrvnpa tgpifvegakegdvlkvkikkievaekgvlatgkglgvlgnlmeglyskvvdikdgkvif neklalpvkpmigvigvapkegsincgtpgshggnmdttliaegaevyfpvfvegallal gdlhalmgdgevgvsgvevagkvllevevikglnlknpvvktaevtatiasaesldkave iavhdmaelfkkhtdlstegiatlfsitgnaqisqvvdplktarfslpnwilesygirf
Timeline for d3tkkc1: