SCOPe 2.01: Domain d3ta1b_: 3ta1 B:

Lineage for d3ta1b_ (3ta1 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (4 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)

8. Domain d3ta1b_: 3ta1 B: [185730]
   automated match to d1qy7a_
   complexed with adp

Details for d3ta1b_

PDB Entry: 3ta1, 1.9 Å

PDB Description: a. fulgidus glnk3, mgadp complex

PDB Compounds: (B:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3ta1b_:

Sequence; same for both SEQRES and ATOM records:

>d3ta1b_ d.58.5.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeevaaa

Timeline for d3ta1b_:

• d3ta1b_ is new in SCOPe 2.01-stable
  
• d3ta1b_ appears in SCOPe 2.02
  
• d3ta1b_ appears in the current release, SCOPe 2.08, called d3ta1b1