Lineage for d3t80c1 (3t80 C:1-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566989Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2566990Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2567088Protein automated matches [190985] (6 species)
    not a true protein
  7. 2567117Species Salmonella typhimurium [TaxId:90371] [189751] (2 PDB entries)
  8. 2567120Domain d3t80c1: 3t80 C:1-156 [185681]
    Other proteins in same PDB: d3t80a2, d3t80b2, d3t80c2, d3t80d2, d3t80e2, d3t80f2
    automated match to d1h48c_
    complexed with ctn, edo, mg, pop, zn

Details for d3t80c1

PDB Entry: 3t80 (more details), 2.5 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3t80c1:

Sequence, based on SEQRES records: (download)

>d3t80c1 d.79.5.1 (C:1-156) automated matches {Salmonella typhimurium [TaxId: 90371]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmdevnvkattteklgftgrgegiaceavallmk

Sequence, based on observed residues (ATOM records): (download)

>d3t80c1 d.79.5.1 (C:1-156) automated matches {Salmonella typhimurium [TaxId: 90371]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedlgchmde
vnvkattteklgftgrgegiaceavallmk

SCOPe Domain Coordinates for d3t80c1:

Click to download the PDB-style file with coordinates for d3t80c1.
(The format of our PDB-style files is described here.)

Timeline for d3t80c1: