Lineage for d3t6dl_ (3t6d L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958970Protein automated matches [190224] (7 species)
    not a true protein
  7. 1958971Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries)
  8. 1958976Domain d3t6dl_: 3t6d L: [185658]
    Other proteins in same PDB: d3t6dc_, d3t6dh1, d3t6dh2
    automated match to d1prcl_
    complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dl_

PDB Entry: 3t6d (more details), 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08
PDB Compounds: (L:) Photosynthetic reaction center L-subunit

SCOPe Domain Sequences for d3t6dl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6dl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d3t6dl_:

Click to download the PDB-style file with coordinates for d3t6dl_.
(The format of our PDB-style files is described here.)

Timeline for d3t6dl_: