Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (7 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries) |
Domain d3t6dl_: 3t6d L: [185658] Other proteins in same PDB: d3t6dc_, d3t6dh1, d3t6dh2 automated match to d1prcl_ complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9 |
PDB Entry: 3t6d (more details), 1.95 Å
SCOPe Domain Sequences for d3t6dl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6dl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]} allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d3t6dl_:
View in 3D Domains from other chains: (mouse over for more information) d3t6dc_, d3t6dh1, d3t6dh2, d3t6dm_ |