SCOPe 2.05: Domain d3t6dl_: 3t6d L:

Lineage for d3t6dl_ (3t6d L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries)

8. Domain d3t6dl_: 3t6d L: [185658]
   Other proteins in same PDB: d3t6dc_, d3t6dh1, d3t6dh2
   automated match to d1prcl_
   complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dl_

PDB Entry: 3t6d, 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08

PDB Compounds: (L:) Photosynthetic reaction center L-subunit

SCOPe Domain Sequences for d3t6dl_:

Sequence; same for both SEQRES and ATOM records:

>d3t6dl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d3t6dl_:

• d3t6dl_ first appeared in SCOPe 2.01
  
• d3t6dl_ appears in SCOPe 2.04
  
• d3t6dl_ appears in SCOPe 2.06
  
• d3t6dl_ appears in the current release, SCOPe 2.08