SCOPe 2.05: Domain d3t6dh2: 3t6d H:37-258

Lineage for d3t6dh2 (3t6d H:37-258)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (3 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [232267] (4 PDB entries)

8. Domain d3t6dh2: 3t6d H:37-258 [239792]
   Other proteins in same PDB: d3t6dc_, d3t6dh1, d3t6dl_, d3t6dm_
   automated match to d3g7fh2
   complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dh2

PDB Entry: 3t6d, 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08

PDB Compounds: (H:) Photosynthetic reaction center H-subunit

SCOPe Domain Sequences for d3t6dh2:

Sequence; same for both SEQRES and ATOM records:

>d3t6dh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsd
qfanvprlqsrdqitlreedkvsayyaggllyatperaeall

Timeline for d3t6dh2:

• d3t6dh2 first appeared in SCOPe 2.04
  
• d3t6dh2 appears in SCOPe 2.06
  
• d3t6dh2 appears in the current release, SCOPe 2.08