Lineage for d3t6dh2 (3t6d H:37-258)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790616Protein automated matches [226918] (3 species)
    not a true protein
  7. 1790617Species Blastochloris viridis [TaxId:1079] [232267] (4 PDB entries)
  8. 1790618Domain d3t6dh2: 3t6d H:37-258 [239792]
    Other proteins in same PDB: d3t6dc_, d3t6dh1, d3t6dl_, d3t6dm_
    automated match to d3g7fh2
    complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dh2

PDB Entry: 3t6d (more details), 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08
PDB Compounds: (H:) Photosynthetic reaction center H-subunit

SCOPe Domain Sequences for d3t6dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6dh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsd
qfanvprlqsrdqitlreedkvsayyaggllyatperaeall

SCOPe Domain Coordinates for d3t6dh2:

Click to download the PDB-style file with coordinates for d3t6dh2.
(The format of our PDB-style files is described here.)

Timeline for d3t6dh2: