Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein GMP-PDE delta [74846] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries) |
Domain d3t5gb_: 3t5g B: [185649] Other proteins in same PDB: d3t5ga_ automated match to d1kshb_ complexed with far, gdp, mg |
PDB Entry: 3t5g (more details), 1.7 Å
SCOPe Domain Sequences for d3t5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t5gb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]} kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvl tgnviietkffdddllvstsrvrlfyv
Timeline for d3t5gb_: