Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (25 PDB entries) Uniprot P05091 |
Domain d3sz9c_: 3sz9 C: [185587] automated match to d1bi9a_ complexed with edo, gai, i3e, na |
PDB Entry: 3sz9 (more details), 2.1 Å
SCOPe Domain Sequences for d3sz9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sz9c_ c.82.1.1 (C:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} qavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavka araafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmv lkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalat gnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftg steigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccag srtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqega kllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannsty glaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqay tevktvtvkvpqkns
Timeline for d3sz9c_: