Lineage for d3sy0a2 (3sy0 A:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749047Domain d3sy0a2: 3sy0 A:108-213 [185582]
    Other proteins in same PDB: d3sy0a1, d3sy0b1, d3sy0b2
    part of Fab s25-2
    complexed with mg, zn

Details for d3sy0a2

PDB Entry: 3sy0 (more details), 1.49 Å

PDB Description: s25-2- a(2-8)-a(2-4)kdo trisaccharide complex
PDB Compounds: (A:) S25-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3sy0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sy0a2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3sy0a2:

Click to download the PDB-style file with coordinates for d3sy0a2.
(The format of our PDB-style files is described here.)

Timeline for d3sy0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sy0a1