Lineage for d3sndb_ (3snd B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129501Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1129546Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1129563Species SARS coronavirus [TaxId:227859] [89349] (57 PDB entries)
  8. 1129581Domain d3sndb_: 3snd B: [185447]
    automated match to d1uj1b_
    complexed with mrd

Details for d3sndb_

PDB Entry: 3snd (more details), 1.89 Å

PDB Description: Crystal structure of SARS coronavirus main protease complexed with Ac-ESTLQ-H (cocrystallization)
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3sndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sndb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d3sndb_:

Click to download the PDB-style file with coordinates for d3sndb_.
(The format of our PDB-style files is described here.)

Timeline for d3sndb_: