![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.13: lambda exonuclease [53017] (1 protein) |
![]() | Protein lambda exonuclease [53018] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [53019] (2 PDB entries) |
![]() | Domain d3slpc_: 3slp C: [185441] automated match to d1avqa_ protein/DNA complex; complexed with ca, cl, po4 |
PDB Entry: 3slp (more details), 2.3 Å
SCOPe Domain Sequences for d3slpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3slpc_ c.52.1.13 (C:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]} mtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfht llaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdg lcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmk reglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr
Timeline for d3slpc_: