Lineage for d3slpc_ (3slp C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994595Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 994596Protein lambda exonuclease [53018] (1 species)
  7. 994597Species Bacteriophage lambda [TaxId:10710] [53019] (2 PDB entries)
  8. 994603Domain d3slpc_: 3slp C: [185441]
    automated match to d1avqa_
    protein/DNA complex; complexed with ca, cl, po4

Details for d3slpc_

PDB Entry: 3slp (more details), 2.3 Å

PDB Description: Crystal Structure of Lambda Exonuclease in Complex with a 12 BP Symmetric DNA Duplex
PDB Compounds: (C:) Exonuclease

SCOPe Domain Sequences for d3slpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slpc_ c.52.1.13 (C:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
mtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfht
llaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdg
lcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmk
reglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d3slpc_:

Click to download the PDB-style file with coordinates for d3slpc_.
(The format of our PDB-style files is described here.)

Timeline for d3slpc_: