SCOPe 2.01: Domain d1agrh_: 1agr H:

Lineage for d1agrh_ (1agr H:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein Regulator of G-protein signaling 4, RGS4 [48099] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)

8. Domain d1agrh_: 1agr H: [18539]
   Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2
   complexed with alf, cit, gdp, mg

Details for d1agrh_

PDB Entry: 1agr, 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

PDB Compounds: (H:) rgs4

SCOPe Domain Sequences for d1agrh_:

Sequence; same for both SEQRES and ATOM records:

>d1agrh_ a.91.1.1 (H:) Regulator of G-protein signaling 4, RGS4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspkakkiynefi
svqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflksrfyl

Timeline for d1agrh_:

• d1agrh_ first appeared (with stable ids) in SCOP 1.55
  
• d1agrh_ appears in SCOP 1.75
  
• d1agrh_ appears in SCOPe 2.02
  
• d1agrh_ appears in the current release, SCOPe 2.08