SCOPe 2.01: Domain d3sf8a_: 3sf8 A:

Lineage for d3sf8a_ (3sf8 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (25 PDB entries)
   Uniprot Q99497

8. Domain d3sf8a_: 3sf8 A: [185364]
   automated match to d1pdwg_

Details for d3sf8a_

PDB Entry: 3sf8, 1.56 Å

PDB Description: Structural insights into thiol stabilization of DJ-1

PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d3sf8a_:

Sequence; same for both SEQRES and ATOM records:

>d3sf8a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlkdle

Timeline for d3sf8a_:

• d3sf8a_ is new in SCOPe 2.01-stable
  
• d3sf8a_ appears in SCOPe 2.02
  
• d3sf8a_ appears in the current release, SCOPe 2.08, called d3sf8a1