Lineage for d1e6ve1 (1e6v E:190-442)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215786Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 215787Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 215788Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 215807Protein Beta chain [48087] (3 species)
  7. 215819Species Archaeon Methanopyrus kandleri [TaxId:2320] [48089] (1 PDB entry)
  8. 215821Domain d1e6ve1: 1e6v E:190-442 [18534]
    Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb2, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve2, d1e6vf_
    complexed with com, f43, tp7

Details for d1e6ve1

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

SCOP Domain Sequences for d1e6ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ve1 a.89.1.1 (E:190-442) Beta chain {Archaeon Methanopyrus kandleri}
gyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqglna
dnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnayaaa
glvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshsiyg
gggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidefrep
mkyiteaaaeeak

SCOP Domain Coordinates for d1e6ve1:

Click to download the PDB-style file with coordinates for d1e6ve1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ve1: