Lineage for d3saoa_ (3sao A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552097Species Chicken (Gallus gallus) [TaxId:9031] [189846] (1 PDB entry)
  8. 1552098Domain d3saoa_: 3sao A: [185326]
    automated match to d1jzua_
    complexed with dbh, fe, gol, nkn

Details for d3saoa_

PDB Entry: 3sao (more details), 1.8 Å

PDB Description: The Siderocalin Ex-FABP functions through dual ligand specificities
PDB Compounds: (A:) Extracellular fatty acid-binding protein

SCOPe Domain Sequences for d3saoa_:

Sequence, based on SEQRES records: (download)

>d3saoa_ b.60.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sevagkwyivalasntdfflaekgkmkmvmarisflgedelevsyaapspkgcrkwettf
kktsddgevyyseeaektvevldtdyksyavifatrvkdgrtlhmmrlysrsrevsptam
aifrklarernytdemvavlpsqaacsvdevlvpr

Sequence, based on observed residues (ATOM records): (download)

>d3saoa_ b.60.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sevagkwyivalasntdfflaekgkmkmvmarisflgedelevsyaapspkgcrkwettf
kkevyyseeaektvevldtdyksyavifatrvkdgrtlhmmrlysrsrevsptamaifrk
larernytdemvavlpsqaacsvdevlvpr

SCOPe Domain Coordinates for d3saoa_:

Click to download the PDB-style file with coordinates for d3saoa_.
(The format of our PDB-style files is described here.)

Timeline for d3saoa_: