Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (5 PDB entries) |
Domain d3s97b_: 3s97 B: [185322] automated match to d1jcza_ complexed with nag |
PDB Entry: 3s97 (more details), 2.3 Å
SCOPe Domain Sequences for d3s97b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s97b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslentfih ntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplemqiy cfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaaldpfi llnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsgyvm lmdylqnnfreqqykfsrqvfssyt
Timeline for d3s97b_: