Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) |
Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
Protein automated matches [191244] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189711] (9 PDB entries) |
Domain d3s4ma_: 3s4m A: [185272] automated match to d1ly7a_ |
PDB Entry: 3s4m (more details), 1.3 Å
SCOPe Domain Sequences for d3s4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s4ma_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkq tpnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk d
Timeline for d3s4ma_: