Lineage for d3s22a_ (3s22 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620536Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)
  8. 2620550Domain d3s22a_: 3s22 A: [185253]
    automated match to d1gcea_
    complexed with 3s2, cl

Details for d3s22a_

PDB Entry: 3s22 (more details), 1.65 Å

PDB Description: amp-c beta-lactamase (pseudomonas aeruginosa) in complex with an inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3s22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s22a_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
apadrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlfei
gsvsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplqfp
dsvqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvfpa
lgleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanlhp
erldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphriarl
papqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsgle
q

SCOPe Domain Coordinates for d3s22a_:

Click to download the PDB-style file with coordinates for d3s22a_.
(The format of our PDB-style files is described here.)

Timeline for d3s22a_: