Lineage for d1b4uc_ (1b4u C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49547Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily)
  4. 49548Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family) (S)
  5. 49549Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein)
  6. 49550Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species)
  7. 49551Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries)
  8. 49555Domain d1b4uc_: 1b4u C: [18524]
    Other proteins in same PDB: d1b4ub_, d1b4ud_

Details for d1b4uc_

PDB Entry: 1b4u (more details), 2.2 Å

PDB Description: protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca)

SCOP Domain Sequences for d1b4uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4uc_ a.88.1.1 (C:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis}
idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
spagvrsikggy

SCOP Domain Coordinates for d1b4uc_:

Click to download the PDB-style file with coordinates for d1b4uc_.
(The format of our PDB-style files is described here.)

Timeline for d1b4uc_: