![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.88: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48075] (1 superfamily) multihelical; contains compact array of 6 short helices |
![]() | Superfamily a.88.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48076] (1 family) ![]() |
![]() | Family a.88.1.1: LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48077] (1 protein) |
![]() | Protein LigA subunit of an aromatic-ring-opening dioxygenase LigAB [48078] (1 species) |
![]() | Species Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId:13689] [48079] (2 PDB entries) |
![]() | Domain d1b4uc_: 1b4u C: [18524] Other proteins in same PDB: d1b4ub_, d1b4ud_ complexed with dhb, fe |
PDB Entry: 1b4u (more details), 2.2 Å
SCOPe Domain Sequences for d1b4uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4uc_ a.88.1.1 (C:) LigA subunit of an aromatic-ring-opening dioxygenase LigAB {Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]} idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr spagvrsikggy
Timeline for d1b4uc_: