SCOPe 2.08: Domain d3ryce1: 3ryc E:5-145

Lineage for d3ryce1 (3ryc E:5-145)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d3ryce1: 3ryc E:5-145 [185203]
   Other proteins in same PDB: d3ryca1, d3ryca2, d3rycb1, d3rycb2, d3rycc1, d3rycc2, d3rycd1, d3rycd2, d3ryce2
   automated match to d1sa0e_
   complexed with gdp, gtp, mg, so4

Details for d3ryce1

PDB Entry: 3ryc, 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ryce1:

Sequence, based on SEQRES records:

>d3ryce1 a.137.10.1 (E:5-145) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records):

>d3ryce1 a.137.10.1 (E:5-145) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaellk
hlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkha
eevrknkelkeeasr

Timeline for d3ryce1:

• d3ryce1 first appeared in SCOPe 2.01, called d3ryce_
  
• d3ryce1 appears in SCOPe 2.07