Lineage for d1f5xa_ (1f5x A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540906Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 540907Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 540908Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
    Pfam 00621
  6. 540947Protein RhoGEF Vav [48071] (1 species)
  7. 540948Species Mouse (Mus musculus) [TaxId:10090] [48072] (1 PDB entry)
  8. 540949Domain d1f5xa_: 1f5x A: [18516]
    autoinhibited

Details for d1f5xa_

PDB Entry: 1f5x (more details)

PDB Description: nmr structure of the y174 autoinhibited dbl homology domain

SCOP Domain Sequences for d1f5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus)}
mkgdeiyedlmrlesvptppkmteydkrccclreiqqteekytdtlgsiqqhfmkplqrf
lkpqdmetifvnieelfsvhthflkelkdalagpgattlyqvfikykerflvygrycsqv
esaskhldqvataredvqmkleecsqranngrftlrdllmvpmqrvlkyhlllqelvkht
qdatekenlrlaldamrdlaqcvnevkr

SCOP Domain Coordinates for d1f5xa_:

Click to download the PDB-style file with coordinates for d1f5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1f5xa_: